PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_014515-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 193aa    MW: 22214.2 Da    PI: 5.122
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_014515-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed++l++++k +G g+W+  +++ g++R++k+c++rw++yl
  AHYPO_014515-RA 14 RGAWTSMEDKILIEYIKAHGEGRWRNLPKRAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding28.83e-096797132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     rg+ T++E+el+++++k+lG++ W++Ia +++
  AHYPO_014515-RA 67 RGNITPDEEELILRLHKLLGNR-WSLIAGRLP 97
                     7999******************.******999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129421.976965IPR017930Myb domain
SMARTSM007174.6E-141363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-231592IPR009057Homeodomain-like
CDDcd001679.36E-111661No hitNo description
PROSITE profilePS500906.52862102IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.8E-1465102IPR009057Homeodomain-like
SMARTSM007170.04466106IPR001005SANT/Myb domain
PfamPF002493.5E-76797IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MGRSPCCVKE GMNRGAWTSM EDKILIEYIK AHGEGRWRNL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI TPDEEELILR LHKLLGNRWS LIAGRLPVYT NNIILSDNHN YSWTRLDEEY  120
NKMSSDFMME NNVNMGDFKL ISELLTTDLM DICDFGNESM SGGSDLSSNS ENDPFIFSQE  180
LLEDWLGDNQ LI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-201210425116MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666251.11e-64PREDICTED: transcription factor MYB23
SwissprotP102904e-53MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A0J8B8961e-64A0A0J8B896_BETVU; Uncharacterized protein
STRINGGLYMA13G16890.14e-62(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.12e-52myb domain protein 7